PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_26166
Common NameKK1_027017
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 228aa    MW: 26971.1 Da    PI: 9.3563
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_26166genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.3e-17449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+++W++Ia+++  gR++k+c++rw++ 
    C.cajan_26166  4 RGHWRPAEDEKLRELVERYGPHNWNAIAEKFR-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding57.92.3e-1856100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r ++T+eE+e+l+  ++ +G++ W+ Iar+++ gRt++ +k++w+  
    C.cajan_26166  56 RSPFTEEEEERLLASHRIHGNR-WAVIARHFP-GRTDNAVKNHWHVM 100
                      789*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.898150IPR017930Myb domain
SMARTSM007173.8E-15352IPR001005SANT/Myb domain
SuperFamilySSF466896.74E-30497IPR009057Homeodomain-like
PfamPF002492.9E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-27557IPR009057Homeodomain-like
CDDcd001671.08E-13748No hitNo description
PROSITE profilePS5129425.25351105IPR017930Myb domain
SMARTSM007171.7E-1655103IPR001005SANT/Myb domain
PfamPF002493.1E-155699IPR001005SANT/Myb domain
CDDcd001671.52E-1258101No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2158103IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLRELVE RYGPHNWNAI AEKFRGRSGK SCRLRWFNQL DPRINRSPFT  60
EEEEERLLAS HRIHGNRWAV IARHFPGRTD NAVKNHWHVM MARIRRERSK IYNAKQPLFP  120
PNIETIPSFV DKYYEKYSSH HHPHNHLQFP NKFYFHHPTS ASTLPPERSQ SVEFYDFLQV  180
NTDSNKSEVT DNAKINIRDD EEVSQDAVGH KNKNNSLPFI DFLSTPAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-3241037106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0928931e-130BT092893.1 Soybean clone JCVI-FLGm-12J9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003533306.11e-134PREDICTED: transcription factor WER-like
TrEMBLA0A151S8I31e-172A0A151S8I3_CAJCA; Transcription factor MYB44
STRINGGLYMA09G29940.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-82myb domain protein 52